H00246778-B01P

IL27 antibody from Abnova Corporation
IL-27, IL-27A, IL27A, IL27p28, IL30, MGC71873, p28

Antibody data

Product number
H00246778-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00246778-B01P, RRID:AB_1137615
Product name
IL27 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00246778-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human IL27 protein.
Antigen sequence
MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGR
PQLSLQELRREFTVSLHLARKLLAEVRGQAHRFAE
SHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPER
LCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAM
RLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEE
ERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSL
ELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -