HPA027534

FAAH2 antibody from Sigma-Aldrich
AMDD, FAAH-2, FLJ31204, RP11-479E16.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027534
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027534, RRID:AB_1848864
Product name
Anti-FAAH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027534
Antibody type
Polyclonal
Antigen
Fatty-acid amide hydrolase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGDHGKHVSPLWELIKWCLGLSVYTIPSIGLALLE
EKLRYSNEKYQKFKAVEESLRKELVDMLGDDGVFL
YPSHPTVAPKHHVPLTRPFNFAYTGVFSALGLPVT
QCPL
Storage
-20C
Provider Type Product Number
- No reagents -