HPA060734

antibody from Atlas Antibodies

Targeting: EHF ESE3, ESEJ

Antibody data

Submit

Validation data

Product number: HPA060734 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA060734, RRID:AB_2684351
Product name: Anti-EHF
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSS GFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDA NCIPFQEFDINGEHL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

EHF protein structure - HPA060734 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human salivary gland and liver tissues using HPA060734 antibody. Corresponding EHF RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human salivary gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human breast shows moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human salivary gland shows strong nuclear positivity in glandular cells.
Sample type: HUMAN