HPA004345

TRIM33 antibody from Sigma-Aldrich
FLJ11429, KIAA1113, PTC7, RFG7, TF1G, TIF1G, TIF1GAMMA, TIFGAMMA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004345
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004345, RRID:AB_1858287
Product name
Anti-TRIM33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004345
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase TRIM33 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MQPHLQRQHSNPGHAGPFPVVSVHNTTINPTSPTT
ATMANANRGPTSPSVTAIELIPSVTNPENLPSLPD
IPPIQLEDAGSSSLDNLLSRYISGSHLPPQPTSTM
NPSPGPSALSPGSSGLSNSHTPVRPPSTSSTGSR
Storage
-20C
Provider Type Product Number
- No reagents -