Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183658 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ring Finger Protein 14 (RNF14) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RNF14 antibody: synthetic peptide directed towards the C terminal of human RNF14
- Description
- Protein A purified
- Reactivity
- Human, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
CMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFY
AVDVD DDIWEDEVED- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Defects in adaptive energy metabolism with CNS-linked hyperactivity in PGC-1alpha null mice.
Negative modulation of androgen receptor transcriptional activity by Daxx.
Lin J, Wu PH, Tarr PT, Lindenberg KS, St-Pierre J, Zhang CY, Mootha VK, Jäger S, Vianna CR, Reznick RM, Cui L, Manieri M, Donovan MX, Wu Z, Cooper MP, Fan MC, Rohas LM, Zavacki AM, Cinti S, Shulman GI, Lowell BB, Krainc D, Spiegelman BM
Cell 2004 Oct 1;119(1):121-35
Cell 2004 Oct 1;119(1):121-35
Negative modulation of androgen receptor transcriptional activity by Daxx.
Lin DY, Fang HI, Ma AH, Huang YS, Pu YS, Jenster G, Kung HJ, Shih HM
Molecular and cellular biology 2004 Dec;24(24):10529-41
Molecular and cellular biology 2004 Dec;24(24):10529-41
No comments: Submit comment
No validations: Submit validation data