HPA008716

RNF14 antibody from Atlas Antibodies
ARA54, HFB30, TRIAD2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008716
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008716, RRID:AB_1856337
Product name
Anti-RNF14
Provider product page
Atlas Antibodies - HPA008716
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKL
MDLRNEYLQADEANKRLLDQRYGKRVIQKALEEME
SKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQ
YFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVD
VDDDIWEDEV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -