HPA008716

RNF14 antibody from Sigma-Aldrich
ARA54, HFB30, TRIAD2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008716
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008716, RRID:AB_1856337
Product name
Anti-RNF14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008716
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase RNF14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKL
MDLRNEYLQADEANKRLLDQRYGKRVIQKALEEME
SKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQ
YFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVD
VDDDIWEDEV
Storage
-20C
Provider Type Product Number
- No reagents -