Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [5]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027067-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027067-M01, RRID:AB_530213
- Product name
- STAU2 monoclonal antibody (M01), clone 5C5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STAU2.
- Antigen sequence
LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANK
ALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGL
AMKRGEPAIYRPLDPKPFP- Isotype
- IgG
- Antibody clone number
- 5C5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STAU2 monoclonal antibody (M01), clone 5C5 Western Blot analysis of STAU2 expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STAU2 monoclonal antibody (M01), clone 5C5. Western Blot analysis of STAU2 expression in COLO 320 HSR ( Cat # L020V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of STAU2 expression in transfected 293T cell line by STAU2 monoclonal antibody (M01), clone 5C5.Lane 1: STAU2 transfected lysate(52.8 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STAU2 monoclonal antibody (M01), clone 5C5. Western Blot analysis of STAU2 expression in NIH/3T3.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STAU2 monoclonal antibody (M01), clone 5C5. Western Blot analysis of STAU2 expression in HL-60.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STAU2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol