HPA019155

STAU2 antibody from Sigma-Aldrich
39K2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019155
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019155, RRID:AB_1857565
Product name
Anti-STAU2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019155
Antibody type
Polyclonal
Antigen
Double-stranded RNA-binding protein Staufen homolog 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANK
ALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGL
AMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRY
HCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAM
KALQ
Storage
-20C
Provider Type Product Number
- No reagents -