HPA020299

VPS41 antibody from Sigma-Aldrich
HVSP41
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020299
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020299, RRID:AB_1858769
Product name
Anti-VPS41 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020299
Antibody type
Polyclonal
Antigen
Vacuolar protein sorting-associated protein 41 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLKPLIYEMILHEFLESDYEGFATLIREWPGDLYN
NSVIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNY
GNALEIYLTLRHKDVFQLIHKHNLFSSIKDKIVLL
MDFDSEKAVDML
Storage
-20C
Provider Type Product Number
- No reagents -