HPA019902

YIPF2 antibody from Atlas Antibodies
FinGER2, MGC3262

Antibody data

Product number
HPA019902
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019902, RRID:AB_1858925
Product name
Anti-YIPF2
Provider product page
Atlas Antibodies - HPA019902
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MASADELTFHEFEEATNLLADTPDAATTSRSDQLT
PQGHVAVAVGSGGSYGAEDEVEEESDKAALLQEQQ
QQQQPGFWTFSYYQSFFDVDTSQVLDRI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.