HPA019902

YIPF2 antibody from Sigma-Aldrich
FinGER2, MGC3262
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019902
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019902, RRID:AB_1858925
Product name
Anti-YIPF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019902
Antibody type
Polyclonal
Antigen
Protein YIPF2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MASADELTFHEFEEATNLLADTPDAATTSRSDQLT
PQGHVAVAVGSGGSYGAEDEVEEESDKAALLQEQQ
QQQQPGFWTFSYYQSFFDVDTSQVLDRI
Storage
-20C
Provider Type Product Number
- No reagents -