H00079977-A01

antibody from Abnova Corporation

Targeting: GRHL2 BOM, DFNA28, FLJ13782, TFCP2L3

No application information provided.

Antibody Data

Product number

H00079977-A01

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#H00079977-A01, RRID:AB_535386

Product name

GRHL2 polyclonal antibody (A01)

Antibody type

Polyclonal

Description

Mouse polyclonal antibody raised against a partial recombinant GRHL2.

Antigen sequence

ENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPE
SSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGE
EQRVVIFEQTQYDVPSLATHSAYLKDDQRS


Storage

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Submitted references

Dual roles of the transcription factor grainyhead-like 2 (GRHL2) in breast cancer.

Werner S, Frey S, Riethdorf S, Schulze C, Alawi M, Kling L, Vafaizadeh V, Sauter G, Terracciano L, Schumacher U, Pantel K, Assmann V
The Journal of biological chemistry 2013 Aug 9;288(32):22993-3008

---

Grainyhead-like 2 (GRHL2) inhibits keratinocyte differentiation through epigenetic mechanism.

Chen W, Xiao Liu Z, Oh JE, Shin KH, Kim RH, Jiang M, Park NH, Kang MK
Cell death & disease 2012 Dec 20;3:e450

---

Grainyhead-like 2 enhances the human telomerase reverse transcriptase gene expression by inhibiting DNA methylation at the 5'-CpG island in normal human keratinocytes.

Chen W, Dong Q, Shin KH, Kim RH, Oh JE, Park NH, Kang MK
The Journal of biological chemistry 2010 Dec 24;285(52):40852-63

---

Regulation of the hTERT promoter activity by MSH2, the hnRNPs K and D, and GRHL2 in human oral squamous cell carcinoma cells.

Kang X, Chen W, Kim RH, Kang MK, Park NH
Oncogene 2009 Jan 29;28(4):565-74