Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405258 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Grainyhead-Like 2 (Drosophila) (GRHL2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GRHL2 antibody: synthetic peptide directed towards the middle region of human GRHL2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VEKIAKLYKKSKKGILVNMDDNIIEHYSNEDTFIL
NMESM VEGFKVTLME- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The grainyhead like 2 gene (GRHL2), alias TFCP2L3, is associated with age-related hearing impairment.
Van Laer L, Van Eyken E, Fransen E, Huyghe JR, Topsakal V, Hendrickx JJ, Hannula S, Mäki-Torkko E, Jensen M, Demeester K, Baur M, Bonaconsa A, Mazzoli M, Espeso A, Verbruggen K, Huyghe J, Huygen P, Kunst S, Manninen M, Konings A, Diaz-Lacava AN, Steffens M, Wienker TF, Pyykkö I, Cremers CW, Kremer H, Dhooge I, Stephens D, Orzan E, Pfister M, Bille M, Parving A, Sorri M, Van de Heyning PH, Van Camp G
Human molecular genetics 2008 Jan 15;17(2):159-69
Human molecular genetics 2008 Jan 15;17(2):159-69
No comments: Submit comment
No validations: Submit validation data