HPA004820

GRHL2 antibody from Atlas Antibodies
BOM, DFNA28, FLJ13782, TFCP2L3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004820
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004820, RRID:AB_1235871
Product name
Anti-GRHL2
Provider product page
Atlas Antibodies - HPA004820
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPES
SAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEE
QRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTY
SESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYT
LEATKSLRQK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -