HPA004820

GRHL2 antibody from Sigma-Aldrich
BOM, DFNA28, FLJ13782, TFCP2L3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004820
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004820, RRID:AB_1857928
Product name
Anti-GRHL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004820
Antibody type
Polyclonal
Antigen
Grainyhead-like protein 2 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPES
SAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEE
QRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTY
SESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYT
LEATKSLRQK
Storage
-20C
Provider Type Product Number
- No reagents -