HPA022246

KIF27 antibody from MilliporeSigma / Merck KGaA
DKFZp434D0917
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022246
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA022246, RRID:AB_1852491
Product name
Anti-KIF27 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA022246
Antibody type
Polyclonal
Antigen
Kinesin-like protein KIF27 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TKLNLSVTSSAKENCGDGPDARIPERRPYTVPFDT
HLGHYIYIPSRQDSRKVHTSPPMYSLDRIFAGFRT
RSQMLLGHIEEQDKVLHCQFSDNSDDEESEGQEKS
GTRCRSRSWIQ
Storage
-20C
Provider Type Product Number
- No reagents -