HPA019535

ELAC2 antibody from Sigma-Aldrich
FLJ10530, HPC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019535
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019535, RRID:AB_1848106
Product name
Anti-ELAC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019535
Antibody type
Polyclonal
Antigen
Zinc phosphodiesterase ELAC protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNL
IHPDIFPLLTSFRCKKEGPTLSVPMVQGECLLKYQ
LRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQ
EYR
Storage
-20C
Provider Type Product Number
- No reagents -