HPA029874

antibody from Atlas Antibodies

Targeting: CAMP CAP18, FALL-39, FALL39, LL37

Antibody data

Submit

Validation data

Product number: HPA029874 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029874, RRID:AB_10600859
Product name: Anti-CAMP
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKE TVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQAR GSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRI VQRIKDFLRNLVPR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CAMP protein structure - HPA029874 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using HPA029874 antibody. Corresponding CAMP RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subsets of bone marrow poietic cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows moderate to strong granular cytoplasmic positivity in hematopoietic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows moderate to strong granular cytoplasmic positivity in leukocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.
Sample type: HUMAN