HPA005708

RPA3 antibody from Sigma-Aldrich
REPA3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005708
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005708, RRID:AB_1856411
Product name
Anti-RPA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005708
Antibody type
Polyclonal
Antigen
Replication protein A 14 kDa subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHP
TGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVG
RVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKII
HDFPQFYP
Storage
-20C
Provider Type Product Number
- No reagents -