H00010201-B02P

NME6 antibody from Abnova Corporation
IPIA-ALPHA, NM23-H6

Antibody data

Product number
H00010201-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010201-B02P, RRID:AB_1578086
Product name
NME6 purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00010201-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NME6 protein.
Antigen sequence
MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPL
ILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYRE
HEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRT
LMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSD
SVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVC
YSPEGGVHYVAGTGGLGPA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -