H00004781-M08

NFIB antibody from Abnova Corporation
NFI-RED, NFIB2, NFIB3

Antibody data

Product number
H00004781-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004781-M08, RRID:AB_1237795
Product name
NFIB monoclonal antibody (M08), clone 2D6
Provider product page
Abnova Corporation - H00004781-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant NFIB.
Antigen sequence
MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQ
ARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQ
KWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCV
LSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKG
IPLESTDGERLMKSPHCTNPALCVQPHHITVSVKE
LDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLED
SFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIP
SQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDEN
MEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTT
MKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV
AHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHP
TIRYPPHLNPQDTLKNYVPSYDPSSPQTSQSWYLG
Isotype
IgG
Antibody clone number
2D6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -