Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003956 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003956, RRID:AB_1854424
- Product name
- Anti-NFIB
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQ
PYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENME
PSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMK
KPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAH
SVISTRTP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references PAX6 does not regulate Nfia and Nfib expression during neocortical development
NFI transcription factors interact with FOXA1 to regulate prostate-specific gene expression.
MiR-153 targets the nuclear factor-1 family and protects against teratogenic effects of ethanol exposure in fetal neural stem cells.
NFIB-mediated repression of the epigenetic factor Ezh2 regulates cortical development.
Bunt J, Lim J, Zhao L, Mason S, Richards L
Scientific Reports 2015 May;5
Scientific Reports 2015 May;5
NFI transcription factors interact with FOXA1 to regulate prostate-specific gene expression.
Grabowska MM, Elliott AD, DeGraff DJ, Anderson PD, Anumanthan G, Yamashita H, Sun Q, Friedman DB, Hachey DL, Yu X, Sheehan JH, Ahn JM, Raj GV, Piston DW, Gronostajski RM, Matusik RJ
Molecular endocrinology (Baltimore, Md.) 2014 Jun;28(6):949-64
Molecular endocrinology (Baltimore, Md.) 2014 Jun;28(6):949-64
MiR-153 targets the nuclear factor-1 family and protects against teratogenic effects of ethanol exposure in fetal neural stem cells.
Tsai PC, Bake S, Balaraman S, Rawlings J, Holgate RR, Dubois D, Miranda RC
Biology open 2014 Jul 25;3(8):741-58
Biology open 2014 Jul 25;3(8):741-58
NFIB-mediated repression of the epigenetic factor Ezh2 regulates cortical development.
Piper M, Barry G, Harvey TJ, McLeay R, Smith AG, Harris L, Mason S, Stringer BW, Day BW, Wray NR, Gronostajski RM, Bailey TL, Boyd AW, Richards LJ
The Journal of neuroscience : the official journal of the Society for Neuroscience 2014 Feb 19;34(8):2921-30
The Journal of neuroscience : the official journal of the Society for Neuroscience 2014 Feb 19;34(8):2921-30
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nucleoli fibrillar center.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle shows strong nuclear positivity in myocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN