HPA003956

NFIB antibody from Atlas Antibodies
NFI-RED, NFIB2, NFIB3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003956
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003956, RRID:AB_1854424
Product name
Anti-NFIB
Provider product page
Atlas Antibodies - HPA003956
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQ
PYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENME
PSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMK
KPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAH
SVISTRTP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -