HPA003956

NFIB antibody from Sigma-Aldrich
NFI-RED, NFIB2, NFIB3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003956
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003956, RRID:AB_1854424
Product name
Anti-NFIB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003956
Antibody type
Polyclonal
Antigen
Nuclear factor 1 B-type recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQ
PYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENME
PSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMK
KPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAH
SVISTRTP
Storage
-20C
Provider Type Product Number
- No reagents -