Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031962 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031962, RRID:AB_10601266
- Product name
- Anti-SREBF2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VNLAECAEEKIPPSTLVEIHLTAAMGLKTRCGGKL
GFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQ
KFFMERSWSVKS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Qki regulates myelinogenesis through Srebp2-dependent cholesterol biosynthesis
SREBP2 is upregulated in esophageal squamous cell carcinoma and co‑operates with c‑Myc to regulate HMGCR expression
Zhou X, Shin S, He C, Zhang Q, Rasband M, Ren J, Dai C, Zorrilla-Veloz R, Shingu T, Yuan L, Wang Y, Chen Y, Lan F, Hu J
eLife 2021;10
eLife 2021;10
SREBP2 is upregulated in esophageal squamous cell carcinoma and co‑operates with c‑Myc to regulate HMGCR expression
Zhong C, Fan L, Li Z, Yao F, Zhao H
Molecular Medicine Reports 2019
Molecular Medicine Reports 2019
No comments: Submit comment
No validations: Submit validation data