Antibody data

Product number
ABIN786556
Provider
antibodies-online
Product name
anti-Sterol Regulatory Element Binding Transcription Factor 2 (SREBF2) (Center) antibody
Provider product page
antibodies-online - ABIN786556
Antibody type
Polyclonal
Antigen
The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2
Reactivity
Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Rabbit
Host
Rabbit
Antigen sequence
VMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNII
EKRYR SSINDKIIEL
Vial size
50 µg
Provider Type Product Number
- No reagents -