ABIN504404

ZBTB48 antibody from antibodies-online
HKR3, TZAP, ZNF855

Antibody data

Product number
ABIN504404
Provider
antibodies-online
Product name
anti-Zinc Finger and BTB Domain Containing 48 (ZBTB48) antibody
Provider product page
antibodies-online - ABIN504404
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZBTB48 antibody: synthetic peptide directed towards the middle region of human ZBTB48
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
EFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTF
RTQAS LDKHNRTHTG
Vial size
50 µg
Provider Type Product Number
- No reagents -