HPA004094

ZFPM2 antibody from Atlas Antibodies
FOG2, hFOG-2, ZC2HC11B, ZNF89B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004094
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004094, RRID:AB_1859058
Product name
Anti-ZFPM2
Provider product page
Atlas Antibodies - HPA004094
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CLPEQEQRPPLVQQRFLDVANLNNPCTSTQEPTEG
LGECYHPRCDIFPGIVSKHLETSLTINKCVPVSKC
DTTHSSVSCLEMDVPIDLSKKCLSQSERTTTSPKR
LLDYHECTVCKISFNKVENYLAHKQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -