HPA004094

ZFPM2 antibody from Sigma-Aldrich
FOG2, hFOG-2, ZC2HC11B, ZNF89B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004094
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004094, RRID:AB_1859058
Product name
Anti-ZFPM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004094
Antibody type
Polyclonal
Antigen
Zinc finger protein ZFPM2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CLPEQEQRPPLVQQRFLDVANLNNPCTSTQEPTEG
LGECYHPRCDIFPGIVSKHLETSLTINKCVPVSKC
DTTHSSVSCLEMDVPIDLSKKCLSQSERTTTSPKR
LLDYHECTVCKISFNKVENYLAHKQ
Storage
-20C
Provider Type Product Number
- No reagents -