HPA003903

VSIG4 antibody from Sigma-Aldrich
Z39IG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003903
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003903, RRID:AB_1858776
Product name
Anti-VSIG4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003903
Antibody type
Polyclonal
Antigen
V-set and immunoglobulin domain-containing protein 4 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIAD
SGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTK
TEAPTTMTYPLKATSTVKQSWDWTTDMDGYL
Storage
-20C
Provider Type Product Number
- No reagents -