HPA003984

OVOL1 antibody from Sigma-Aldrich
HOVO1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003984
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003984, RRID:AB_1854854
Product name
Anti-OVOL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003984
Antibody type
Polyclonal
Antigen
Putative transcription factor Ovo-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLG
FCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSM
APGPCVVAQLPSEDMGHLTDPQSRDHGFLRTK
Storage
-20C
Provider Type Product Number
- No reagents -