Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA020031 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA020031, RRID:AB_1851791
- Product name
- Anti-INHBA
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVG
KVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAE
SGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPK
ANRTRTKVTIRLFQQQKHPQGSLDTGEE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Identification of a Biomarker Combination for Survival Stratification in pStage II/III Gastric Cancer after Curative Resection
Genome-Wide Analysis of Barrett's Adenocarcinoma. A First Step Towards Identifying Patients at Risk and Developing Therapeutic Paths
Activin receptors regulate the oligodendrocyte lineage in health and disease.
Activin A programs the differentiation of human TFH cells
Activin Upregulation by NF-κB Is Required to Maintain Mesenchymal Features of Cancer Stem–like Cells in Non–Small Cell Lung Cancer
Translational regulation of inhibin βA by TGFβ via the RNA-binding protein hnRNP E1 enhances the invasiveness of epithelial-to-mesenchymal transitioned cells
Hashimoto I, Kimura Y, Oue N, Hiroshima Y, Aoyama T, Rino Y, Yokose T, Yasui W, Miyagi Y, Oshima T
Cancers 2022;14(18):4427
Cancers 2022;14(18):4427
Genome-Wide Analysis of Barrett's Adenocarcinoma. A First Step Towards Identifying Patients at Risk and Developing Therapeutic Paths
Dai Y, Wang Q, Gonzalez Lopez A, Anders M, Malfertheiner P, Vieth M, Kemmner W
Translational Oncology 2018;11(1):116-124
Translational Oncology 2018;11(1):116-124
Activin receptors regulate the oligodendrocyte lineage in health and disease.
Dillenburg A, Ireland G, Holloway RK, Davies CL, Evans FL, Swire M, Bechler ME, Soong D, Yuen TJ, Su GH, Becher JC, Smith C, Williams A, Miron VE
Acta neuropathologica 2018 Jun;135(6):887-906
Acta neuropathologica 2018 Jun;135(6):887-906
Activin A programs the differentiation of human TFH cells
Locci M, Wu J, Arumemi F, Mikulski Z, Dahlberg C, Miller A, Crotty S
Nature Immunology 2016;17(8):976-984
Nature Immunology 2016;17(8):976-984
Activin Upregulation by NF-κB Is Required to Maintain Mesenchymal Features of Cancer Stem–like Cells in Non–Small Cell Lung Cancer
Wamsley J, Kumar M, Allison D, Clift S, Holzknecht C, Szymura S, Hoang S, Xu X, Moskaluk C, Jones D, Bekiranov S, Mayo M
Cancer Research 2015;75(2):426-435
Cancer Research 2015;75(2):426-435
Translational regulation of inhibin βA by TGFβ via the RNA-binding protein hnRNP E1 enhances the invasiveness of epithelial-to-mesenchymal transitioned cells
Howley B, Hussey G, Link L, Howe P
Oncogene 2015;35(13):1725-1735
Oncogene 2015;35(13):1725-1735
No comments: Submit comment
No validations: Submit validation data