Antibody data

Product number
PAB21841
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21841, RRID:AB_10964980
Product name
PHF13 polyclonal antibody
Provider product page
Abnova Corporation - PAB21841
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant PHF13.
Antigen sequence
GKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSW
DLVTCFCMKPFAGRPMIECNECHT
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -