HPA026830

PHF13 antibody from Sigma-Aldrich
MGC43399
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026830
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026830, RRID:AB_1855288
Product name
Anti-PHF13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026830
Antibody type
Polyclonal
Antigen
PHD finger protein 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSW
DLVTCFCMKPFAGRPMIECNECHT
Storage
-20C
Provider Type Product Number
- No reagents -