Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023311 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023311, RRID:AB_1857067
- Product name
- Anti-SLC28A3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNN
SIRSRAVQSREHTNTKQDEEQVTVEQDSPRNREHM
EDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRH- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Epithelial-to-mesenchymal transition is dispensable for metastasis but induces chemoresistance in pancreatic cancer.
The oncogenic receptor ErbB2 modulates gemcitabine and irinotecan/SN-38 chemoresistance of human pancreatic cancer cells via hCNT1 transporter and multidrug-resistance associated protein MRP-2.
The MUC4 mucin mediates gemcitabine resistance of human pancreatic cancer cells via the Concentrative Nucleoside Transporter family.
Zheng X, Carstens JL, Kim J, Scheible M, Kaye J, Sugimoto H, Wu CC, LeBleu VS, Kalluri R
Nature 2015 Nov 26;527(7579):525-530
Nature 2015 Nov 26;527(7579):525-530
The oncogenic receptor ErbB2 modulates gemcitabine and irinotecan/SN-38 chemoresistance of human pancreatic cancer cells via hCNT1 transporter and multidrug-resistance associated protein MRP-2.
Skrypek N, Vasseur R, Vincent A, DuchĂȘne B, Van Seuningen I, Jonckheere N
Oncotarget 2015 May 10;6(13):10853-67
Oncotarget 2015 May 10;6(13):10853-67
The MUC4 mucin mediates gemcitabine resistance of human pancreatic cancer cells via the Concentrative Nucleoside Transporter family.
Skrypek N, DuchĂȘne B, Hebbar M, Leteurtre E, van Seuningen I, Jonckheere N
Oncogene 2013 Mar 28;32(13):1714-23
Oncogene 2013 Mar 28;32(13):1714-23
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong membranous positivity in exocrine glandular cells.
- Sample type
- HUMAN