HPA023311

SLC28A3 antibody from Sigma-Aldrich
CNT3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023311
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023311, RRID:AB_1857067
Product name
Anti-SLC28A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023311
Antibody type
Polyclonal
Antigen
Solute carrier family 28 member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNN
SIRSRAVQSREHTNTKQDEEQVTVEQDSPRNREHM
EDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRH
Storage
-20C
Provider Type Product Number
- No reagents -