Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002057-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002057-M01, RRID:AB_606196
- Product name
- EPOR monoclonal antibody (M01), clone 3D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EPOR.
- Antigen sequence
PDPKFESKAALLAARGPEELLCFTERLEDLVCFWE
EAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTAR
GAVRFWCSLPTADTSSFVPLELRVTAASGA- Isotype
- IgG
- Antibody clone number
- 3D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EPOR expression in transfected 293T cell line by EPOR monoclonal antibody (M01), clone 3D10.Lane 1: EPOR transfected lysate (Predicted MW: 55.1 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EPOR monoclonal antibody (M01), clone 3D10. Western Blot analysis of EPOR expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EPOR is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of EPOR transfected lysate using anti-EPOR monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EPOR MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol