HPA005824

HEPH antibody from Sigma-Aldrich
CPL, KIAA0698
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005824
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005824, RRID:AB_1850603
Product name
Anti-HEPH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005824
Antibody type
Polyclonal
Antigen
Hephaestin Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLQGMRKGAAMLFPHTFVMAIMQPDNLGTFEIYCQ
AGSHREAGMRAIYNVSQCPGHQATPRQRYQAARIY
YIMAEEVEWDYCPDRSWEREWHNQSEKDSYGYIFL
SNKDGLLGSRYKKAVFREYTDGTFRIPRPRTGPEE
HLGILGPLI
Storage
-20C
Provider Type Product Number
- No reagents -