HPA004051

ZNF384 antibody from Sigma-Aldrich
CAGH1A, CIZ, NMP4, NP, TNRC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004051
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004051, RRID:AB_1859228
Product name
Anti-ZNF384 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004051
Antibody type
Polyclonal
Antigen
Zinc finger protein 384 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLP
EKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKS
DQLTPHSQASVTQNITVVPVPSTGLMTA
Storage
-20C
Provider Type Product Number
- No reagents -