HPA020120

C7orf25 antibody from MilliporeSigma / Merck KGaA
MGC2821
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020120
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020120, RRID:AB_1845755
Product name
Anti-C7orf25 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020120
Antibody type
Polyclonal
Antigen
UPF0415 protein C7orf25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPGERERATVLIKRINVVPDQPSERALRLVASSKI
NSRSLTIFGTGDTLKAITMTANSGFVRAANNQGVK
FSVFIHQPRALTESKEALATPLPKDYTTD
Storage
-20C
Provider Type Product Number
- No reagents -