Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010146-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010146-M01, RRID:AB_464246
- Product name
- G3BP monoclonal antibody (M01), clone 2F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant G3BP.
- Antigen sequence
KPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRT
FSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPR
PESKPESQIPPQRPQRDQRV- Isotype
- IgG
- Antibody clone number
- 2F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references 5-Fluorouracil affects assembly of stress granules based on RNA incorporation.
Deficiency of G3BP1, the stress granules assembly factor, results in abnormal synaptic plasticity and calcium homeostasis in neurons.
Progressive loss of dopaminergic neurons induced by unilateral rotenone infusion into the medial forebrain bundle.
Kaehler C, Isensee J, Hucho T, Lehrach H, Krobitsch S
Nucleic acids research 2014 Jun;42(10):6436-47
Nucleic acids research 2014 Jun;42(10):6436-47
Deficiency of G3BP1, the stress granules assembly factor, results in abnormal synaptic plasticity and calcium homeostasis in neurons.
Martin S, Zekri L, Metz A, Maurice T, Chebli K, Vignes M, Tazi J
Journal of neurochemistry 2013 Apr;125(2):175-84
Journal of neurochemistry 2013 Apr;125(2):175-84
Progressive loss of dopaminergic neurons induced by unilateral rotenone infusion into the medial forebrain bundle.
Norazit A, Meedeniya AC, Nguyen MN, Mackay-Sim A
Brain research 2010 Nov 11;1360:119-29
Brain research 2010 Nov 11;1360:119-29
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- G3BP monoclonal antibody (M01), clone 2F3 Western Blot analysis of G3BP expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of G3BP expression in transfected 293T cell line by G3BP monoclonal antibody (M01), clone 2F3.Lane 1: G3BP transfected lysate(52.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged G3BP1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to G3BP on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to G3BP on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
