HPA004052

G3BP1 antibody from Atlas Antibodies
G3BP, HDH-VIII
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA004052
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004052, RRID:AB_1234409
Product name
Anti-G3BP1
Provider product page
Atlas Antibodies - HPA004052
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEV
VPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEP
EPEQEPVSEIQEEKPEPVLEETAP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -