HPA004052

G3BP1 antibody from Sigma-Aldrich
G3BP, HDH-VIII
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004052
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004052, RRID:AB_1849348
Product name
Anti-G3BP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004052
Antibody type
Polyclonal
Antigen
Ras GTPase-activating protein-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEV
VPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEP
EPEQEPVSEIQEEKPEPVLEETAP
Storage
-20C
Provider Type Product Number
- No reagents -