HPA024087

TUFM antibody from Sigma-Aldrich
EF-TuMT, EFTu
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024087
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024087, RRID:AB_1858459
Product name
Anti-TUFM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024087
Antibody type
Polyclonal
Antigen
Elongation factor Tu, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVT
GTLERGILKKGDECELLGHSKNIRTVVTGIEMFHK
SLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSI
Storage
-20C
Provider Type Product Number
- No reagents -