HPA004171

AUH antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004171
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004171, RRID:AB_1845215
Product name
Anti-AUH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004171
Antibody type
Polyclonal
Antigen
Methylglutaconyl-CoA hydratase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGP
APKRGYSSEMKTEDELRVRHLEEENRGIVVLGINR
AYGKNSLSKNLIKMLSKAVDALKSDKK
Storage
-20C
Provider Type Product Number
- No reagents -