Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501486 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 268A (ZNF286A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF286A antibody: synthetic peptide directed towards the N terminal of human ZNF286A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine
- Host
- Rabbit
- Antigen sequence
SSYSDMETRPQSKDSTSVQDFSKAESCKVAIIDRL
TRNSV YDSNLEAALE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T
DNA research : an international journal for rapid publication of reports on genes and genomes 2002 Jun 30;9(3):99-106
DNA research : an international journal for rapid publication of reports on genes and genomes 2002 Jun 30;9(3):99-106
No comments: Submit comment
No validations: Submit validation data