ABIN309607

YAF2 antibody from antibodies-online
Western blot
Data presented on provider website
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN309607
Provider
antibodies-online
Product name
anti-YY1 Associated Factor 2 (YAF2) antibody
Provider product page
antibodies-online - ABIN309607
Antibody type
Polyclonal
Antigen
The immunogen for anti-YAF2 antibody: synthetic peptide directed towards the middle region of human YAF2
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
KGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKD
KVEKE KSEKETTSKK
Vial size
0.1 mg