HPA026867

YAF2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026867
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026867, RRID:AB_1858911
Product name
Anti-YAF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026867
Antibody type
Polyclonal
Antigen
YY1-associated factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVP
PTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRL
KNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPAS
SAASADQHSQSGSSSDNTERGMSRSSS
Storage
-20C
Provider Type Product Number
- No reagents -