HPA024284

SNX31 antibody from Sigma-Aldrich
MGC39715
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024284
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024284, RRID:AB_1853894
Product name
Anti-SNX31 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024284
Antibody type
Polyclonal
Antigen
Sorting nexin-31 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEAFQKEDSQTKFLELAREVRHYGYLQLDPCTCDY
PESGSGAVLSVGNNEISCCITLPDSQTQDIVFQMS
RVKCWQVTFLGTLLDTDGPQRTLNQNLE
Storage
-20C
Provider Type Product Number
- No reagents -