Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007545-M11 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007545-M11, RRID:AB_894332
- Product name
- ZIC1 monoclonal antibody (M11), clone 2F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ZIC1.
- Antigen sequence
GHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYP
RPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHH
GAGA- Isotype
- IgG
- Antibody clone number
- 2F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ZIC1 monoclonal antibody (M11), clone 2F6. Western Blot analysis of ZIC1 expression in IMR-32.